SCOP 1.75: Domain d2as0a1: 2as0 A:1-72

Lineage for d2as0a1 (2as0 A:1-72)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein PH1915, N-terminal domain [141721] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [141722] (1 PDB entry)
   Uniprot O59578 1-72

8. Domain d2as0a1: 2as0 A:1-72 [127227]
   Other proteins in same PDB: d2as0a2, d2as0b2

Details for d2as0a1

PDB Entry: 2as0, 1.8 Å

PDB Description: Crystal Structure of PH1915 (APC 5817): A Hypothetical RNA Methyltransferase

PDB Compounds: (A:) hypothetical protein PH1915

SCOP Domain Sequences for d2as0a1:

Sequence; same for both SEQRES and ATOM records:

>d2as0a1 b.122.1.9 (A:1-72) Hypothetical protein PH1915, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsni
mvrivtkdkdve

Timeline for d2as0a1:

• d2as0a1 first appeared in SCOP 1.73
  
• d2as0a1 appears in SCOPe 2.01
  
• d2as0a1 appears in the current release, SCOPe 2.08