Lineage for d2as0b1 (2as0 B:1-72)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813297Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
    N-terminal part of Pfam PF03602, structurally similar to PUA domain family
  6. 813298Protein Hypothetical protein PH1915, N-terminal domain [141721] (1 species)
  7. 813299Species Archaeon Pyrococcus horikoshii [TaxId:53953] [141722] (1 PDB entry)
    Uniprot O59578 1-72
  8. 813301Domain d2as0b1: 2as0 B:1-72 [127229]
    Other proteins in same PDB: d2as0a2, d2as0b2
    automatically matched to 2AS0 A:1-72

Details for d2as0b1

PDB Entry: 2as0 (more details), 1.8 Å

PDB Description: Crystal Structure of PH1915 (APC 5817): A Hypothetical RNA Methyltransferase
PDB Compounds: (B:) hypothetical protein PH1915

SCOP Domain Sequences for d2as0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as0b1 b.122.1.9 (B:1-72) Hypothetical protein PH1915, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsni
mvrivtkdkdve

SCOP Domain Coordinates for d2as0b1:

Click to download the PDB-style file with coordinates for d2as0b1.
(The format of our PDB-style files is described here.)

Timeline for d2as0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2as0b2