![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species) |
![]() | Species Plasmodium yoelii [TaxId:5861] [141753] (1 PDB entry) Uniprot Q7RPE4 2-322 |
![]() | Domain d2aqwa1: 2aqw A:2-322 [127184] complexed with iod, so4 |
PDB Entry: 2aqw (more details), 2 Å
SCOPe Domain Sequences for d2aqwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aqwa1 c.1.2.3 (A:2-322) Protozoan orotidine monophosphate decarboxylase {Plasmodium yoelii [TaxId: 5861]} hfktklknrrsevntclcigldpdeddiknfmkneeqngykniknnmnsnnngieniiki gkeilltdgeniqnlseedkffyffnhfcfyiinntkeyalvykmnfafyipygsvgina lknvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtnmlkdicf dyeknkyysayvlikttnkdsfifqnelsindkqayivmadetqkmatelkieqnnefig fvvgsnafeemkiirnkfpdsyilspgigaqngdlyktlkngynkdyekllinvgraitk spdpkkssesyynqiiqifkd
Timeline for d2aqwa1: