SCOPe 2.08: Domain d2aq2b1: 2aq2 B:2-116

Lineage for d2aq2b1 (2aq2 B:2-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
   Uniprot P23313

8. Domain d2aq2b1: 2aq2 B:2-116 [127146]
   Other proteins in same PDB: d2aq2a1, d2aq2b2
   automated match to d3byyb1
   complexed with na, so4, zn; mutant

Details for d2aq2b1

PDB Entry: 2aq2, 1.8 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant

PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq2b1:

Sequence; same for both SEQRES and ATOM records:

>d2aq2b1 b.40.2.2 (B:2-116) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwpgktcmyggitkh

Timeline for d2aq2b1:

• d2aq2b1 first appeared in SCOP 1.73
  
• d2aq2b1 appears in SCOPe 2.07