Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins) |
Protein Streptococcal superantigen SSA [50238] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [50239] (4 PDB entries) |
Domain d2aq2b1: 2aq2 B:2-119 [127146] Other proteins in same PDB: d2aq2b2 automatically matched to d1bxta1 complexed with na, so4, zn; mutant |
PDB Entry: 2aq2 (more details), 1.8 Å
SCOP Domain Sequences for d2aq2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq2b1 b.40.2.2 (B:2-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]} sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwpgktcmyggitkhegn
Timeline for d2aq2b1: