SCOPe 2.04: Domain d2ap1a1: 2ap1 A:118-303

Lineage for d2ap1a1 (2ap1 A:118-303)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK [110636] (8 proteins)
   Pfam PF00480

6. Protein Putative regulator protein YcfX [142475] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [142476] (1 PDB entry)
   Uniprot Q8ZPZ9 1-117! Uniprot Q8ZPZ9 118-303

8. Domain d2ap1a1: 2ap1 A:118-303 [127108]
   complexed with na, zn

Details for d2ap1a1

PDB Entry: 2ap1, 1.9 Å

PDB Description: crystal structure of the putative regulatory protein

PDB Compounds: (A:) putative regulator protein

SCOPe Domain Sequences for d2ap1a1:

Sequence; same for both SEQRES and ATOM records:

>d2ap1a1 c.55.1.10 (A:118-303) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]}
eftqyplvmglilgtgvggglvlngkpitgqsyitgefghmrlpvdaltlmgfdfplrrc
gcgqmgcienylsgrgfawlyqhyydqslqapeiialweqgdeqahahveryldllavcl
gniltivdpdllviggglsnftaittqlaerlprhllpvaraprierarhgdaggmrgaa
flhltd

Timeline for d2ap1a1:

• d2ap1a1 first appeared in SCOP 1.73
  
• d2ap1a1 appears in SCOPe 2.03
  
• d2ap1a1 appears in SCOPe 2.05
  
• d2ap1a1 appears in the current release, SCOPe 2.08