Lineage for d2aoja_ (2aoj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799327Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (7 PDB entries)
  8. 2799340Domain d2aoja_: 2aoj A: [127094]
    automated match to d1fgcc_
    complexed with acy, dms, gol

Details for d2aoja_

PDB Entry: 2aoj (more details), 1.6 Å

PDB Description: crystal structure analysis of hiv-1 protease with a substrate analog p6-pr
PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d2aoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aoja_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d2aoja_:

Click to download the PDB-style file with coordinates for d2aoja_.
(The format of our PDB-style files is described here.)

Timeline for d2aoja_: