SCOPe 2.05: Domain d2anee_: 2ane E:

Lineage for d2anee_ (2ane E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.10: LON domain-like [141723] (3 proteins)
   Pfam PF02190

6. Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species)

7. Species Escherichia coli [TaxId:562] [141725] (1 PDB entry)
   Uniprot P0A9M0 8-117

8. Domain d2anee_: 2ane E: [127050]
   automated match to d2anea1

Details for d2anee_

PDB Entry: 2ane, 2.03 Å

PDB Description: crystal structure of n-terminal domain of e.coli lon protease

PDB Compounds: (E:) ATP-dependent protease La

SCOPe Domain Sequences for d2anee_:

Sequence; same for both SEQRES and ATOM records:

>d2anee_ b.122.1.10 (E:) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]}
rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl

Timeline for d2anee_:

• d2anee_ first appeared in SCOP 1.73, called d2anee1
  
• d2anee_ appears in SCOPe 2.04
  
• d2anee_ appears in SCOPe 2.06
  
• d2anee_ appears in the current release, SCOPe 2.08