Lineage for d2anee1 (2ane E:8-117)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680488Family b.122.1.10: LON domain-like [141723] (2 proteins)
    Pfam PF02190
  6. 680489Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species)
  7. 680490Species Escherichia coli [TaxId:562] [141725] (1 PDB entry)
  8. 680495Domain d2anee1: 2ane E:8-117 [127050]
    automatically matched to 2ANE A:8-117

Details for d2anee1

PDB Entry: 2ane (more details), 2.03 Å

PDB Description: crystal structure of n-terminal domain of e.coli lon protease
PDB Compounds: (E:) ATP-dependent protease La

SCOP Domain Sequences for d2anee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2anee1 b.122.1.10 (E:8-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]}
rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd
lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl

SCOP Domain Coordinates for d2anee1:

Click to download the PDB-style file with coordinates for d2anee1.
(The format of our PDB-style files is described here.)

Timeline for d2anee1: