SCOP 1.75: Domain d2anec1: 2ane C:10-117

Lineage for d2anec1 (2ane C:10-117)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.10: LON domain-like [141723] (2 proteins)
   Pfam PF02190

6. Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species)

7. Species Escherichia coli [TaxId:562] [141725] (1 PDB entry)
   Uniprot P0A9M0 8-117

8. Domain d2anec1: 2ane C:10-117 [127048]
   automatically matched to 2ANE A:8-117

Details for d2anec1

PDB Entry: 2ane, 2.03 Å

PDB Description: crystal structure of n-terminal domain of e.coli lon protease

PDB Compounds: (C:) ATP-dependent protease La

SCOP Domain Sequences for d2anec1:

Sequence; same for both SEQRES and ATOM records:

>d2anec1 b.122.1.10 (C:10-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]}
eipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvndlf
tvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl

Timeline for d2anec1:

• d2anec1 first appeared in SCOP 1.73
  
• d2anec1 is called d2anec_ in SCOPe 2.01
  
• d2anec1 appears in the current release, SCOPe 2.08, called d2anec_