![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (13 families) ![]() |
![]() | Family b.122.1.10: LON domain-like [141723] (2 proteins) Pfam PF02190 |
![]() | Protein ATP-dependent protease La (Lon), N-terminal domain [141724] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141725] (1 PDB entry) Uniprot P0A9M0 8-117 |
![]() | Domain d2anea1: 2ane A:8-117 [127046] |
PDB Entry: 2ane (more details), 2.03 Å
SCOP Domain Sequences for d2anea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2anea1 b.122.1.10 (A:8-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]} rieipvlplrdvvvyphmviplfvgreksircleaamdhdkkimlvaqkeastdepgvnd lftvgtvasilqmlklpdgtvkvlveglqrarisalsdngehfsakaeyl
Timeline for d2anea1: