| Class b: All beta proteins [48724] (174 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (4 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins) |
| Protein Cyclophilin (eukaryotic) [50893] (13 species) |
| Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries) Uniprot P05092 |
| Domain d2alfa1: 2alf A:2-165 [126975] complexed with mg; mutant |
PDB Entry: 2alf (more details), 1.9 Å
SCOP Domain Sequences for d2alfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alfa1 b.62.1.1 (A:2-165) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktkw
ldgkhvvfgavkegmniveamerfgsrngktskkitiadcgqle
Timeline for d2alfa1: