| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Enolase [54828] (9 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries) |
| Domain d2al1a2: 2al1 A:1-141 [126950] Other proteins in same PDB: d2al1a1, d2al1b1 automated match to d1onea2 complexed with 2pg, cl, k, mg, pep |
PDB Entry: 2al1 (more details), 1.5 Å
SCOPe Domain Sequences for d2al1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2al1a2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt
Timeline for d2al1a2: