Lineage for d2ajtb2 (2ajt B:1-328)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709715Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 709716Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (2 families) (S)
  5. 709726Family c.85.1.2: AraA N-terminal and middle domain-like [142760] (1 protein)
    N-terminal part of Pfam PF02610
  6. 709727Protein L-arabinose isomerase AraA [142761] (1 species)
  7. 709728Species Escherichia coli [TaxId:562] [142762] (2 PDB entries)
  8. 709730Domain d2ajtb2: 2ajt B:1-328 [126897]
    Other proteins in same PDB: d2ajta1, d2ajtb1, d2ajtc1
    automatically matched to 2AJT A:1-328

Details for d2ajtb2

PDB Entry: 2ajt (more details), 2.6 Å

PDB Description: crystal structure of l-arabinose isomerase from e.coli
PDB Compounds: (B:) L-arabinose isomerase

SCOP Domain Sequences for d2ajtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajtb2 c.85.1.2 (B:1-328) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
ygfagegdwktaallrimkvmstglqgg

SCOP Domain Coordinates for d2ajtb2:

Click to download the PDB-style file with coordinates for d2ajtb2.
(The format of our PDB-style files is described here.)

Timeline for d2ajtb2: