PDB entry 2ajt

View 2ajt on RCSB PDB site
Description: Crystal structure of L-Arabinose Isomerase from E.coli
Class: isomerase
Keywords: ISOMERASE, Arabinose catabolism, Carbohydrate metabolism, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2005-08-02, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-arabinose isomerase
    Species: Escherichia coli
    Gene: araA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08202 (0-End)
      • see remark 999 (71)
    Domains in SCOP 1.73: d2ajta1, d2ajta2
  • Chain 'B':
    Compound: L-arabinose isomerase
    Species: Escherichia coli
    Gene: araA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08202 (0-End)
      • see remark 999 (71)
    Domains in SCOP 1.73: d2ajtb1, d2ajtb2
  • Chain 'C':
    Compound: L-arabinose isomerase
    Species: Escherichia coli
    Gene: araA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08202 (0-End)
      • see remark 999 (71)
    Domains in SCOP 1.73: d2ajtc1, d2ajtc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ajtA (A:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygfrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ajtA (A:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ajtB (B:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygfrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ajtB (B:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ajtC (C:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygfrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ajtC (C:)
    mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
    taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
    mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
    fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
    patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
    ygfagegdwktaallrimkvmstglqggtsfmedytyhfekgndlvlgshmlevcpsiav
    eekpildvqhlgiggkddparlifntqtgpaivaslidlgdryrllvncidtvktphslp
    klpvanalwkaqpdlptaseawilaggahhtvfshalnlndmrqfaemhdieitvidndt
    rlpafkdalrwnevyygf