SCOPe 2.08: Domain d2ajbc2: 2ajb C:509-766

Lineage for d2ajbc2 (2ajb C:509-766)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries)

8. Domain d2ajbc2: 2ajb C:509-766 [126863]
   Other proteins in same PDB: d2ajba1, d2ajbb1, d2ajbc1, d2ajbd1
   automated match to d1orva2
   complexed with 0qg, nag, so4

Details for d2ajbc2

PDB Entry: 2ajb, 2.75 Å

PDB Description: porcine dipeptidyl peptidase iv (cd26) in complex with the tripeptide tert-butyl-gly-l-pro-l-ile (tbu-gpi)

PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2ajbc2:

Sequence; same for both SEQRES and ATOM records:

>d2ajbc2 c.69.1.24 (C:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

Timeline for d2ajbc2:

• d2ajbc2 first appeared in SCOP 1.73
  
• d2ajbc2 appears in SCOPe 2.07