![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein MW0638 [143690] (1 species) SA0631 ortholog |
![]() | Species Staphylococcus aureus [TaxId:1280] [143691] (1 PDB entry) Uniprot Q8NXQ8 1-118 |
![]() | Domain d2aj6a1: 2aj6 A:1-118 [126841] complexed with so4, unl |
PDB Entry: 2aj6 (more details), 1.63 Å
SCOPe Domain Sequences for d2aj6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} mrtlnkdehnyikqianihetllsqvesnykctklsialryemicsrlehtndkiyiyen egqliafiwghfsneksmvniellyvepqfrklgiatqlkialekwaktmnakrisnt
Timeline for d2aj6a1: