Lineage for d2aj6a1 (2aj6 A:1-118)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921408Protein Hypothetical protein MW0638 [143690] (1 species)
    SA0631 ortholog
  7. 1921409Species Staphylococcus aureus [TaxId:1280] [143691] (1 PDB entry)
    Uniprot Q8NXQ8 1-118
  8. 1921410Domain d2aj6a1: 2aj6 A:1-118 [126841]
    complexed with so4, unl

Details for d2aj6a1

PDB Entry: 2aj6 (more details), 1.63 Å

PDB Description: Crystal structure of a putative gnat family acetyltransferase (mw0638) from staphylococcus aureus subsp. aureus at 1.63 A resolution
PDB Compounds: (A:) hypothetical protein MW0638

SCOPe Domain Sequences for d2aj6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}
mrtlnkdehnyikqianihetllsqvesnykctklsialryemicsrlehtndkiyiyen
egqliafiwghfsneksmvniellyvepqfrklgiatqlkialekwaktmnakrisnt

SCOPe Domain Coordinates for d2aj6a1:

Click to download the PDB-style file with coordinates for d2aj6a1.
(The format of our PDB-style files is described here.)

Timeline for d2aj6a1: