SCOPe 2.08: Domain d2aj6a1: 2aj6 A:1-118

Lineage for d2aj6a1 (2aj6 A:1-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein MW0638 [143690] (1 species)
   SA0631 ortholog

7. Species Staphylococcus aureus [TaxId:1280] [143691] (1 PDB entry)
   Uniprot Q8NXQ8 1-118

8. Domain d2aj6a1: 2aj6 A:1-118 [126841]
   Other proteins in same PDB: d2aj6a2
   complexed with so4, unl

Details for d2aj6a1

PDB Entry: 2aj6, 1.63 Å

PDB Description: Crystal structure of a putative gnat family acetyltransferase (mw0638) from staphylococcus aureus subsp. aureus at 1.63 A resolution

PDB Compounds: (A:) hypothetical protein MW0638

SCOPe Domain Sequences for d2aj6a1:

Sequence; same for both SEQRES and ATOM records:

>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}
mrtlnkdehnyikqianihetllsqvesnykctklsialryemicsrlehtndkiyiyen
egqliafiwghfsneksmvniellyvepqfrklgiatqlkialekwaktmnakrisnt

Timeline for d2aj6a1:

• d2aj6a1 first appeared in SCOP 1.73
  
• d2aj6a1 appears in SCOPe 2.07