Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins) contains three domains of this fold; "Helical backbone" holds domains 2 and 3 both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 |
Protein automated matches [190199] (1 species) not a true protein |
Species Azotobacter vinelandii [TaxId:354] [186943] (4 PDB entries) |
Domain d2afkc_: 2afk C: [126696] Other proteins in same PDB: d2afkb_, d2afkd_, d2afke_, d2afkf_, d2afkg_, d2afkh_ automated match to d1h1la_ complexed with acp, ca, cfn, clf, hca, mg, sf4 |
PDB Entry: 2afk (more details), 2.3 Å
SCOPe Domain Sequences for d2afkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2afkc_ c.92.2.3 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]} sreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgcay agskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdiv fggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrce gfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrillee mglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgptk tieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhvi gayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligsg ikekfifqkmgipfremhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe
Timeline for d2afkc_: