Class b: All beta proteins [48724] (165 folds) |
Fold b.95: Ganglioside M2 (gm2) activator [63706] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.95.1: Ganglioside M2 (gm2) activator [63707] (1 family) |
Family b.95.1.1: Ganglioside M2 (gm2) activator [63708] (1 protein) |
Protein Ganglioside M2 (gm2) activator [63709] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63710] (7 PDB entries) |
Domain d2af9a1: 2af9 A:0-162 [126667] automatically matched to d1pu5a_ complexed with dao, ipa, myr, ola |
PDB Entry: 2af9 (more details), 2 Å
SCOP Domain Sequences for d2af9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2af9a1 b.95.1.1 (A:0-162) Ganglioside M2 (gm2) activator {Human (Homo sapiens) [TaxId: 9606]} mssfswdncdegkdpavirsltlepdpivvpgnvtlsvvgstsvplssplkvdlvlekev aglwikipctdyigsctfehfcdvldmliptgepcpeplrtyglpchcpfkegtyslpks efvvpdlelpswlttgnyriesvlsssgkrlgcikiaaslkgi
Timeline for d2af9a1: