Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
Protein Imidazole glycerol phosphate dehydratase [102767] (3 species) |
Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry) Uniprot P64373 1-84! Uniprot P64373 85-179 |
Domain d2ae8d2: 2ae8 D:85-179 [126611] automated match to d2ae8a2 complexed with mg |
PDB Entry: 2ae8 (more details), 2.01 Å
SCOPe Domain Sequences for d2ae8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ae8d2 d.14.1.9 (D:85-179) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]} hfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinar ltthidlirggnthheieaifkafsralgialtat
Timeline for d2ae8d2: