| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
| Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein) duplication; there are two structural repeats of this fold |
| Protein Imidazole glycerol phosphate dehydratase [102767] (3 species) |
| Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry) |
| Domain d2ae8d2: 2ae8 D:85-179 [126611] automatically matched to 2AE8 A:85-179 complexed with mg |
PDB Entry: 2ae8 (more details), 2.01 Å
SCOP Domain Sequences for d2ae8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ae8d2 d.14.1.9 (D:85-179) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
hfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinar
ltthidlirggnthheieaifkafsralgialtat
Timeline for d2ae8d2: