SCOP 1.73: Domain d2ae8d2: 2ae8 D:85-179

Lineage for d2ae8d2 (2ae8 D:85-179)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
   duplication; there are two structural repeats of this fold

6. Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry)

8. Domain d2ae8d2: 2ae8 D:85-179 [126611]
   automatically matched to 2AE8 A:85-179
   complexed with mg

Details for d2ae8d2

PDB Entry: 2ae8, 2.01 Å

PDB Description: crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315

PDB Compounds: (D:) Imidazoleglycerol-phosphate dehydratase

SCOP Domain Sequences for d2ae8d2:

Sequence; same for both SEQRES and ATOM records:

>d2ae8d2 d.14.1.9 (D:85-179) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
hfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinar
ltthidlirggnthheieaifkafsralgialtat

Timeline for d2ae8d2:

• d2ae8d2 is new in SCOP 1.73
  
• d2ae8d2 appears in SCOP 1.75
  
• d2ae8d2 appears in the current release, SCOPe 2.08