SCOPe 2.03: Domain d2ad7d_: 2ad7 D:

Lineage for d2ad7d_ (2ad7 D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein Methanol dehydrogenase, light chain [48668] (3 species)

7. Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (5 PDB entries)

8. Domain d2ad7d_: 2ad7 D: [126575]
   Other proteins in same PDB: d2ad7a_, d2ad7c_
   automated match to d4aahb_
   complexed with ca, pqq

Details for d2ad7d_

PDB Entry: 2ad7, 1.5 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C) in the presence of methanol

PDB Compounds: (D:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d2ad7d_:

Sequence; same for both SEQRES and ATOM records:

>d2ad7d_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

Timeline for d2ad7d_:

• d2ad7d_ first appeared in SCOP 1.73, called d2ad7d1
  
• d2ad7d_ appears in SCOPe 2.02
  
• d2ad7d_ appears in SCOPe 2.04
  
• d2ad7d_ appears in the current release, SCOPe 2.08