Lineage for d2ad7d_ (2ad7 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733707Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2733708Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2733709Protein Methanol dehydrogenase, light chain [48668] (3 species)
  7. 2733719Species Methylophilus methylotrophus, w3a1 [TaxId:17] [48669] (6 PDB entries)
  8. 2733723Domain d2ad7d_: 2ad7 D: [126575]
    Other proteins in same PDB: d2ad7a_, d2ad7c_
    automated match to d4aahb_
    complexed with ca, pqq

Details for d2ad7d_

PDB Entry: 2ad7 (more details), 1.5 Å

PDB Description: crystal structure of methanol dehydrogenase from M. W3A1 (form C) in the presence of methanol
PDB Compounds: (D:) methanol dehydrogenase subunit 2

SCOPe Domain Sequences for d2ad7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ad7d_ a.137.2.1 (D:) Methanol dehydrogenase, light chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}
ydgqnckepgncwenkpgypekiagskydpkhdpvelnkqeesikamdarnakrianaks
sgnfvfdvk

SCOPe Domain Coordinates for d2ad7d_:

Click to download the PDB-style file with coordinates for d2ad7d_.
(The format of our PDB-style files is described here.)

Timeline for d2ad7d_: