Lineage for d2abwa1 (2abw A:2-219)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2117753Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2117896Protein Pyridoxine biosynthesis protein 2, Pdx2 [142068] (1 species)
  7. 2117897Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142069] (1 PDB entry)
    Uniprot Q5ND68 2-219
  8. 2117898Domain d2abwa1: 2abw A:2-219 [126535]
    Other proteins in same PDB: d2abwa2, d2abwb2, d2abwb3
    complexed with pg4

Details for d2abwa1

PDB Entry: 2abw (more details), 1.62 Å

PDB Description: glutaminase subunit of the plasmodial plp synthase (vitamin b6 biosynthesis)
PDB Compounds: (A:) Pdx2 protein

SCOPe Domain Sequences for d2abwa1:

Sequence, based on SEQRES records: (download)

>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
seitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrcc
ayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditicr
nfygsqndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpni
iaaveqnnclgtvfhpellphtafqqyfyekvknykys

Sequence, based on observed residues (ATOM records): (download)

>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
seitigvlslqgdfephinhfiklqipslniiqvrnvhdlglcdglvipggesttvrrcc
ayendtlynalvhfihvlkkpiwgtcagcillsknveniklysnfgnkfsfgglditicr
nfndsficslniisdssafkkdltaacirapyireilsdevkvlatfshesygpniiaav
eqnnclgtvfhpellphtafqqyfyekvknykys

SCOPe Domain Coordinates for d2abwa1:

Click to download the PDB-style file with coordinates for d2abwa1.
(The format of our PDB-style files is described here.)

Timeline for d2abwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2abwa2