![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
![]() | Protein Protein ThiJ (YajL) [142070] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142071] (1 PDB entry) Uniprot Q46948 2-196 |
![]() | Domain d2ab0a1: 2ab0 A:2-196 [126501] Other proteins in same PDB: d2ab0b_ |
PDB Entry: 2ab0 (more details), 1.1 Å
SCOPe Domain Sequences for d2ab0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev asqlvmaagiynyye
Timeline for d2ab0a1: