|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest | 
|  | Superfamily c.47.1: Thioredoxin-like [52833] (24 families)  | 
|  | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) | 
|  | Protein automated matches [227019] (4 species) not a true protein | 
|  | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225817] (3 PDB entries) | 
|  | Domain d2aawc2: 2aaw C:1-85 [126499] Other proteins in same PDB: d2aawa1, d2aawc1 automated match to d1okta2 complexed with dtl, gtx, p33 | 
PDB Entry: 2aaw (more details), 2.4 Å
SCOPe Domain Sequences for d2aawc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aawc2 c.47.1.5 (C:1-85) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni
Timeline for d2aawc2: