Lineage for d2aage_ (2aag E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961428Family d.80.1.6: MSAD-like [143532] (1 protein)
  6. 2961429Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)
  7. 2961430Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
    Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230
  8. 2961441Domain d2aage_: 2aag E: [126479]
    Other proteins in same PDB: d2aagb3
    automated match to d2aaga1
    mutant

Details for d2aage_

PDB Entry: 2aag (more details), 1.85 Å

PDB Description: crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities
PDB Compounds: (E:) Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d2aage_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aage_ d.80.1.6 (E:) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
pllkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
rssavvlltvisrprseeqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
aefltgdlv

SCOPe Domain Coordinates for d2aage_:

Click to download the PDB-style file with coordinates for d2aage_.
(The format of our PDB-style files is described here.)

Timeline for d2aage_: