Lineage for d2a94a2 (2a94 A:165-329)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938897Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (13 PDB entries)
  8. 1938899Domain d2a94a2: 2a94 A:165-329 [126424]
    Other proteins in same PDB: d2a94a1
    automated match to d1t2da2
    complexed with ap0

Details for d2a94a2

PDB Entry: 2a94 (more details), 1.5 Å

PDB Description: structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2a94a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a94a2 d.162.1.1 (A:165-329) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklisd
aeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqyghs
difggtpvvlgangveqvielqlnseekakfdeaiaetkrmkala

SCOPe Domain Coordinates for d2a94a2:

Click to download the PDB-style file with coordinates for d2a94a2.
(The format of our PDB-style files is described here.)

Timeline for d2a94a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a94a1