Lineage for d2a94a2 (2a94 A:164-328)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737029Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 737030Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 737031Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 737038Protein Lactate dehydrogenase [56339] (15 species)
  7. 737114Species Plasmodium berghei [TaxId:5821] [103325] (7 PDB entries)
  8. 737118Domain d2a94a2: 2a94 A:164-328 [126424]
    Other proteins in same PDB: d2a94a1
    automatically matched to d1oc4a2
    complexed with ap0

Details for d2a94a2

PDB Entry: 2a94 (more details), 1.5 Å

PDB Description: structure of plasmodium falciparum lactate dehydrogenase complexed to apadh.
PDB Compounds: (A:) l-lactate dehydrogenase

SCOP Domain Sequences for d2a94a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a94a2 d.162.1.1 (A:164-328) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqygh
sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkal

SCOP Domain Coordinates for d2a94a2:

Click to download the PDB-style file with coordinates for d2a94a2.
(The format of our PDB-style files is described here.)

Timeline for d2a94a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a94a1