Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins) |
Protein Lactate dehydrogenase [51859] (14 species) |
Species Plasmodium berghei [TaxId:5821] [102165] (7 PDB entries) |
Domain d2a94a1: 2a94 A:18-163 [126423] Other proteins in same PDB: d2a94a2 automatically matched to d1oc4a1 complexed with ap0 |
PDB Entry: 2a94 (more details), 1.5 Å
SCOP Domain Sequences for d2a94a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a94a1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Plasmodium berghei [TaxId: 5821]} apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf iivvtnpvdvmvqllhqhsgvpknkiigl
Timeline for d2a94a1: