Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (49 species) not a true protein |
Species Pectobacterium carotovorum [TaxId:554] [255028] (1 PDB entry) |
Domain d2a81b_: 2a81 B: [126384] automated match to d4fzwc_ complexed with aco, bcn |
PDB Entry: 2a81 (more details), 3.15 Å
SCOPe Domain Sequences for d2a81b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a81b_ c.14.1.0 (B:) automated matches {Pectobacterium carotovorum [TaxId: 554]} mvfeensdevrvitldhpnkhnpfsrtletsvkdalaranaddsvravvvyggaersfsa ggdfnevkqlsrsedieewidrvidlyqavlnvnkptiaavdgyaigmgfqfalmfdqrl mastanfvmpelkhgigcsvgaailgfthgfstmqeiiyqcqsldaprcvdyrlvnqvve ssalldaaitqahvmasypasafintkravnkpfihlleqtrdaskavhka
Timeline for d2a81b_: