Lineage for d2a81b1 (2a81 B:1-230)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690797Protein Carbapenem biosynthes protein CarB [142004] (1 species)
  7. 690798Species Pectobacterium carotovorum [TaxId:554] [142005] (2 PDB entries)
  8. 690809Domain d2a81b1: 2a81 B:1-230 [126384]
    automatically matched to 2A7K A:1-230
    complexed with aco, bcn

Details for d2a81b1

PDB Entry: 2a81 (more details), 3.15 Å

PDB Description: carboxymethylproline synthase (carb) from pectobacterium carotovora, complexed with acetyl coa and bicine
PDB Compounds: (B:) CarB

SCOP Domain Sequences for d2a81b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a81b1 c.14.1.3 (B:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}
mvfeensdevrvitldhpnkhnpfsrtletsvkdalaranaddsvravvvyggaersfsa
ggdfnevkqlsrsedieewidrvidlyqavlnvnkptiaavdgyaigmgfqfalmfdqrl
mastanfvmpelkhgigcsvgaailgfthgfstmqeiiyqcqsldaprcvdyrlvnqvve
ssalldaaitqahvmasypasafintkravnkpfihlleqtrdaskavhk

SCOP Domain Coordinates for d2a81b1:

Click to download the PDB-style file with coordinates for d2a81b1.
(The format of our PDB-style files is described here.)

Timeline for d2a81b1: