Lineage for d2a7wi1 (2a7w I:4-94)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651014Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 651015Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 651055Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. 651056Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (4 species)
  7. 651062Species Chromobacterium violaceum [TaxId:536] [140800] (1 PDB entry)
  8. 651071Domain d2a7wi1: 2a7w I:4-94 [126377]
    automatically matched to 2A7W A:4-94

Details for d2a7wi1

PDB Entry: 2a7w (more details), 2.8 Å

PDB Description: crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7
PDB Compounds: (I:) Phosphoribosyl-ATP pyrophosphatase

SCOP Domain Sequences for d2a7wi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7wi1 a.204.1.4 (I:4-94) Phosphoribosyl-ATP pyrophosphatase HisE {Chromobacterium violaceum [TaxId: 536]}
dvlkniadtlearreaapqssyvaslfhkgedailkkvaeeaaetlmaskdkdklhlvre
vadlwfhtmvlltyhglrpedvvmelhrreg

SCOP Domain Coordinates for d2a7wi1:

Click to download the PDB-style file with coordinates for d2a7wi1.
(The format of our PDB-style files is described here.)

Timeline for d2a7wi1: