Lineage for d2a6ea1 (2a6e A:1-49,A:173-229)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656918Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1657041Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 1657042Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1657043Protein RNA polymerase alpha [55259] (3 species)
  7. 1657058Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1657099Domain d2a6ea1: 2a6e A:1-49,A:173-229 [126240]
    Other proteins in same PDB: d2a6ea2, d2a6eb2, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek2, d2a6el2, d2a6em_, d2a6en_, d2a6eo_, d2a6ep1, d2a6ep2, d2a6ep3
    automated match to d1smya1
    complexed with mg, zn

Details for d2a6ea1

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ea1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2a6ea1:

Click to download the PDB-style file with coordinates for d2a6ea1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ea1: