Lineage for d2a6aa2 (2a6a A:104-193)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171832Family c.55.1.9: YeaZ-like [110633] (2 proteins)
    Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity
  6. 1171833Protein Hypothetical protein TM0874 [142467] (1 species)
  7. 1171834Species Thermotoga maritima [TaxId:2336] [142468] (1 PDB entry)
    Uniprot Q9WZX7 1-103! Uniprot Q9WZX7 104-193
  8. 1171836Domain d2a6aa2: 2a6a A:104-193 [126232]
    complexed with unl

Details for d2a6aa2

PDB Entry: 2a6a (more details), 2.5 Å

PDB Description: crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution
PDB Compounds: (A:) hypothetical protein TM0874

SCOPe Domain Sequences for d2a6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6aa2 c.55.1.9 (A:104-193) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]}
dgvvlvarrarkgyhycavylkdkglnplkepsvvsdeeleeitkefspkivlkddllis
pavlveeserlfrekktihyyeieplylqk

SCOPe Domain Coordinates for d2a6aa2:

Click to download the PDB-style file with coordinates for d2a6aa2.
(The format of our PDB-style files is described here.)

Timeline for d2a6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a6aa1