Lineage for d2a69p2 (2a69 P:319-423)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260831Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1260839Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 1260850Species Thermus thermophilus [TaxId:274] [88667] (10 PDB entries)
    Uniprot Q9WX78
  8. 1260860Domain d2a69p2: 2a69 P:319-423 [126229]
    Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c_, d2a69d_, d2a69e_, d2a69f1, d2a69f3, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m_, d2a69n_, d2a69o_, d2a69p1, d2a69p3
    automated match to d1smyf2
    protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69p2

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a69p2:

Sequence, based on SEQRES records: (download)

>d2a69p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d2a69p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOPe Domain Coordinates for d2a69p2:

Click to download the PDB-style file with coordinates for d2a69p2.
(The format of our PDB-style files is described here.)

Timeline for d2a69p2: