Lineage for d2a69k1 (2a69 K:1-49,K:173-229)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420028Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1420151Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1420152Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 1420153Protein RNA polymerase alpha [55259] (3 species)
  7. 1420168Species Thermus thermophilus [TaxId:274] [75478] (13 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1420199Domain d2a69k1: 2a69 K:1-49,K:173-229 [126221]
    Other proteins in same PDB: d2a69a2, d2a69b2, d2a69c_, d2a69d_, d2a69e_, d2a69f1, d2a69f2, d2a69f3, d2a69k2, d2a69l2, d2a69m_, d2a69n_, d2a69o_, d2a69p1, d2a69p2, d2a69p3
    automated match to d1smya1
    protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69k1

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a69k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69k1 d.74.3.1 (K:1-49,K:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2a69k1:

Click to download the PDB-style file with coordinates for d2a69k1.
(The format of our PDB-style files is described here.)

Timeline for d2a69k1: