Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d2a69a2: 2a69 A:50-172 [126212] Other proteins in same PDB: d2a69a1, d2a69b1, d2a69c_, d2a69d_, d2a69e_, d2a69f1, d2a69f2, d2a69f3, d2a69k1, d2a69l1, d2a69m_, d2a69n_, d2a69o_, d2a69p1, d2a69p2, d2a69p3 automated match to d1smya2 protein/RNA complex; complexed with mg, rpt, zn |
PDB Entry: 2a69 (more details), 2.5 Å
SCOPe Domain Sequences for d2a69a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a69a2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d2a69a2: