Lineage for d2a69e_ (2a69 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734752Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2734753Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2734771Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 2734780Domain d2a69e_: 2a69 E: [126217]
    Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c_, d2a69d_, d2a69f1, d2a69f2, d2a69f3, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m_, d2a69n_, d2a69p1, d2a69p2, d2a69p3
    automated match to d1iw7e_
    protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69e_

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (E:) RNA polymerase omega chain

SCOPe Domain Sequences for d2a69e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69e_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d2a69e_:

Click to download the PDB-style file with coordinates for d2a69e_.
(The format of our PDB-style files is described here.)

Timeline for d2a69e_: