Lineage for d2a68o1 (2a68 O:2-96)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778858Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 778859Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 778860Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
    4 helices; irregular array
  6. 778861Protein RNA polymerase omega subunit [63564] (3 species)
  7. 778869Species Thermus thermophilus [TaxId:274] [74729] (9 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 778875Domain d2a68o1: 2a68 O:2-96 [126207]
    Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68c1, d2a68d1, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m1, d2a68n1, d2a68p1, d2a68p2, d2a68p3
    automatically matched to d1iw7e_
    complexed with mg, rbt, zn

Details for d2a68o1

PDB Entry: 2a68 (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin
PDB Compounds: (O:) RNA polymerase omega chain

SCOP Domain Sequences for d2a68o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a68o1 a.143.1.1 (O:2-96) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOP Domain Coordinates for d2a68o1:

Click to download the PDB-style file with coordinates for d2a68o1.
(The format of our PDB-style files is described here.)

Timeline for d2a68o1: