Class a: All alpha proteins [46456] (284 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein) 4 helices; irregular array |
Protein RNA polymerase omega subunit [63564] (3 species) |
Species Thermus thermophilus [TaxId:274] [74729] (9 PDB entries) Uniprot Q8RQE7; part of multichain biological unit |
Domain d2a68o1: 2a68 O:2-96 [126207] Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68c1, d2a68d1, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m1, d2a68n1, d2a68p1, d2a68p2, d2a68p3 automatically matched to d1iw7e_ complexed with mg, rbt, zn |
PDB Entry: 2a68 (more details), 2.5 Å
SCOP Domain Sequences for d2a68o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a68o1 a.143.1.1 (O:2-96) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d2a68o1: