SCOP 1.75: Domain d2a5sa1: 2a5s A:7-142,A:145-285

Lineage for d2a5sa1 (2a5s A:7-142,A:145-285)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein N-methyl-D-aspartate receptor subunit 1 [89787] (2 species)

7. Species Rat (Rattus norvegicus), subtype 2A [TaxId:10116] [142803] (2 PDB entries)
   Uniprot Q00959 404-539,661-801

8. Domain d2a5sa1: 2a5s A:7-142,A:145-285 [126178]
   complexed with glu

Details for d2a5sa1

PDB Entry: 2a5s, 1.7 Å

PDB Description: crystal structure of the nr2a ligand binding core in complex with glutamate

PDB Compounds: (A:) N-methyl-D-aspartate receptor NMDAR2A subunit

SCOP Domain Sequences for d2a5sa1:

Sequence, based on SEQRES records:

>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrXqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
alqkgspwkrqidlallqfvgdgemeeletlwltgich

Sequence, based on observed residues (ATOM records):

>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]}
nhlsivtleeapfvivedidpletcvrntvpcrkfvkinnstnegmnvkkcckgfcidil
kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf
svpfvetgisvmvsrXqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhqy
mtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygia
lqkgspwkrqidlallqfvgdgemeeletlwltgich

Timeline for d2a5sa1:

• d2a5sa1 first appeared in SCOP 1.73
  
• d2a5sa1 appears in SCOPe 2.01
  
• d2a5sa1 appears in the current release, SCOPe 2.08