Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species) |
Species Norway rat (Rattus norvegicus), subtype 2A [TaxId:10116] [142803] (1 PDB entry) Uniprot Q00959 404-539,661-801 |
Domain d2a5sa1: 2a5s A:7-142,A:145-285 [126178] complexed with glu |
PDB Entry: 2a5s (more details), 1.7 Å
SCOPe Domain Sequences for d2a5sa1:
Sequence, based on SEQRES records: (download)
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd fsvpfvetgisvmvsrXqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi alqkgspwkrqidlallqfvgdgemeeletlwltgich
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} nhlsivtleeapfvivedidpletcvrntvpcrkfvkinnstnegmnvkkcckgfcidil kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf svpfvetgisvmvsrXqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhqy mtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygia lqkgspwkrqidlallqfvgdgemeeletlwltgich
Timeline for d2a5sa1: