SCOPe 2.02: Domain d2a40d2: 2a40 D:147-366

Lineage for d2a40d2 (2a40 D:147-366)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d2a40d2: 2a40 D:147-366 [126141]
   Other proteins in same PDB: d2a40b_, d2a40e_
   automatically matched to d1hlua2
   protein/DNA complex; complexed with atp, ca, gol, mg

Details for d2a40d2

PDB Entry: 2a40, 1.8 Å

PDB Description: ternary complex of the wh2 domain of wave with actin-dnase i

PDB Compounds: (D:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2a40d2:

Sequence; same for both SEQRES and ATOM records:

>d2a40d2 c.55.1.1 (D:147-366) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeag

Timeline for d2a40d2:

• d2a40d2 first appeared in SCOP 1.73
  
• d2a40d2 appears in SCOPe 2.01
  
• d2a40d2 appears in SCOPe 2.03
  
• d2a40d2 appears in the current release, SCOPe 2.08