Lineage for d2a40d1 (2a40 D:7-146)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857403Protein Actin [53073] (7 species)
  7. 1857429Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1857458Domain d2a40d1: 2a40 D:7-146 [126140]
    Other proteins in same PDB: d2a40b_, d2a40e_
    automatically matched to d1hlua1
    protein/DNA complex; complexed with atp, ca, gol, mg

Details for d2a40d1

PDB Entry: 2a40 (more details), 1.8 Å

PDB Description: ternary complex of the wh2 domain of wave with actin-dnase i
PDB Compounds: (D:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2a40d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a40d1 c.55.1.1 (D:7-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
alvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
lkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfet
fnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d2a40d1:

Click to download the PDB-style file with coordinates for d2a40d1.
(The format of our PDB-style files is described here.)

Timeline for d2a40d1: