Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Actin [53073] (10 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries) Uniprot P02568 ! SQ 02568 |
Domain d2a40d1: 2a40 D:7-146 [126140] Other proteins in same PDB: d2a40b_, d2a40e_ automatically matched to d1hlua1 protein/DNA complex; complexed with atp, ca, gol, mg |
PDB Entry: 2a40 (more details), 1.8 Å
SCOPe Domain Sequences for d2a40d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a40d1 c.55.1.1 (D:7-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} alvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt lkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfet fnvpamyvaiqavlslyasg
Timeline for d2a40d1:
View in 3D Domains from other chains: (mouse over for more information) d2a40a1, d2a40a2, d2a40b_, d2a40e_ |