Lineage for d2a40b_ (2a40 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676253Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1676254Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1676255Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1676264Protein Deoxyribonuclease I [56225] (1 species)
  7. 1676265Species Cow (Bos taurus) [TaxId:9913] [56226] (11 PDB entries)
  8. 1676266Domain d2a40b_: 2a40 B: [126139]
    Other proteins in same PDB: d2a40a1, d2a40a2, d2a40d1, d2a40d2
    automated match to d1dnka_
    protein/DNA complex; complexed with atp, ca, gol, mg

Details for d2a40b_

PDB Entry: 2a40 (more details), 1.8 Å

PDB Description: ternary complex of the wh2 domain of wave with actin-dnase i
PDB Compounds: (B:) Deoxyribonuclease-1

SCOPe Domain Sequences for d2a40b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a40b_ d.151.1.1 (B:) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]}
lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
lsnemalaisdhypvevtlt

SCOPe Domain Coordinates for d2a40b_:

Click to download the PDB-style file with coordinates for d2a40b_.
(The format of our PDB-style files is described here.)

Timeline for d2a40b_: