Lineage for d2a3xg1 (2a3x G:1-204)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794846Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 794874Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 794875Species Human (Homo sapiens) [TaxId:9606] [49953] (6 PDB entries)
  8. 794922Domain d2a3xg1: 2a3x G:1-204 [126125]
    automatically matched to d1gyka_
    complexed with ca, cpk

Details for d2a3xg1

PDB Entry: 2a3x (more details), 3 Å

PDB Description: Decameric crystal structure of human serum amyloid P-component bound to Bis-1,2-{[(Z)-2carboxy- 2-methyl-1,3-dioxane]- 5-yloxycarbonyl}-piperazine
PDB Compounds: (G:) serum amyloid p-component

SCOP Domain Sequences for d2a3xg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3xg1 b.29.1.5 (G:1-204) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d2a3xg1:

Click to download the PDB-style file with coordinates for d2a3xg1.
(The format of our PDB-style files is described here.)

Timeline for d2a3xg1: