Lineage for d2a3xg_ (2a3x G:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. Domain d2a3xg_: 2a3x G: [126125]
    automated match to d4avsa_
    complexed with ca, cpk

Details for d2a3xg_

PDB Entry: 2a3x (more details), 3 Å

PDB Description: Decameric crystal structure of human serum amyloid P-component bound to Bis-1,2-{[(Z)-2carboxy- 2-methyl-1,3-dioxane]- 5-yloxycarbonyl}-piperazine
PDB Compounds: (G:) serum amyloid p-component

SCOPe Domain Sequences for d2a3xg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3xg_ b.29.1.5 (G:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d2a3xg_ are not available.

Timeline for d2a3xg_:

Domains from other chains:
(mouse over for more information)
d2a3xa_, d2a3xb_, d2a3xc_, d2a3xd_, d2a3xe_, d2a3xf_, d2a3xh_, d2a3xi_, d2a3xj_