Lineage for d2a33b_ (2a33 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922908Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
    Pfam PF03641
  6. 2922909Protein Hypothetical protein At2g37210/T2N18.3 [142344] (1 species)
  7. 2922910Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142345] (2 PDB entries)
    Uniprot Q8L8B8 8-190
  8. 2922914Domain d2a33b_: 2a33 B: [126071]
    automated match to d2a33a1
    complexed with mg, so4

Details for d2a33b_

PDB Entry: 2a33 (more details), 1.95 Å

PDB Description: x-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at2g37210
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2a33b_:

Sequence, based on SEQRES records: (download)

>d2a33b_ c.129.1.1 (B:) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
rhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggygtleellev
itwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkkle
e

Sequence, based on observed residues (ATOM records): (download)

>d2a33b_ c.129.1.1 (B:) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
rhvigiipkgetvgevravadmhqrkaemakhsdafialpggygtleellevitwaqlgi
hdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee

SCOPe Domain Coordinates for d2a33b_:

Click to download the PDB-style file with coordinates for d2a33b_.
(The format of our PDB-style files is described here.)

Timeline for d2a33b_: